Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-393.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P03172

Expression Region

26-393

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYA VLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPY NKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAG WHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQ DVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAP PSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF ELISA Kit| Rabbit
EF016887 96 Tests

VEGF ELISA Kit| Rabbit

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), 0.2mg/mL
BNUB1880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), 0.2mg/mL

Sign In for Pricing
View Details
VIPAR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2816906 1.0 µg DNA

VIPAR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ASC/TMS1 Rabbit Polyclonal Antibody (BF680)
orb2440718 100 µL

ASC/TMS1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16980061 1.0 µg DNA

CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TANK Polyclonal Antibody, PerCP Conjugated
bs-1355R-PerCP 100 µL

TANK Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details