Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 2 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-393.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P03172

Expression Region

26-393

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYA VLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPY NKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAG WHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQ DVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAP PSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MLP2 Polyclonal Antibody
MBS7156791 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MLP2 Polyclonal Antibody

Sign In for Pricing
View Details
Equine Coronavirus One-Step PCR kit
Oneq-V587-50R 50 Reactions

Equine Coronavirus One-Step PCR kit

Sign In for Pricing
View Details
CCT3 Antibody
RQ4525 100 µg

CCT3 Antibody

Sign In for Pricing
View Details
DNAJC5G CRISPRa sgRNA lentivector (set of three targets)(Human)
18416121 3x 1.0µg DNA

DNAJC5G CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Geobacter uraniireducens Probable DNA repair protein Gura_3455 (Gura_3455)
MBS1038396-01 0.02 mg (E-Coli)

Recombinant Geobacter uraniireducens Probable DNA repair protein Gura_3455 (Gura_3455)

Sign In for Pricing
View Details
Recombinant Geobacter uraniireducens Probable DNA repair protein Gura_3455 (Gura_3455)
MBS1038396-02 0.1 mg (E-Coli)

Recombinant Geobacter uraniireducens Probable DNA repair protein Gura_3455 (Gura_3455)

Sign In for Pricing
View Details