Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein I (gI)

This Recombinant Human herpesvirus 1 Envelope glycoprotein I (gI) spans the amino acid sequence from region 21-390.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P06487

Expression Region

21-390

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYP MGHKCPRVVHVVTVTACPRRPAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRD YAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATR ATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQRRYRRSRRPIYSPQMPTGIS CAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPT TPTPTPPLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BMP4 protein
MBS1561312-01 0.05 mg

Recombinant Human BMP4 protein

Sign In for Pricing
View Details
Recombinant Human BMP4 protein
MBS1561312-02 0.1 mg

Recombinant Human BMP4 protein

Sign In for Pricing
View Details
Recombinant Human BMP4 protein
MBS1561312-03 5x 0.1 mg

Recombinant Human BMP4 protein

Sign In for Pricing
View Details
ITIH6 Human shRNA Plasmid Kit (Locus ID 347365)
TR303871 1 Kit

ITIH6 Human shRNA Plasmid Kit (Locus ID 347365)

Sign In for Pricing
View Details
TP73 Polyclonal Antibody
MBS2549833-01 0.02 mL

TP73 Polyclonal Antibody

Sign In for Pricing
View Details
TP73 Polyclonal Antibody
MBS2549833-02 0.06 mL

TP73 Polyclonal Antibody

Sign In for Pricing
View Details