Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein I (gI)

This Recombinant Human herpesvirus 1 Envelope glycoprotein I (gI) spans the amino acid sequence from region 21-390.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P06487

Expression Region

21-390

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYP MGHKCPRVVHVVTVTACPRRPAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRD YAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATR ATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQRRYRRSRRPIYSPQMPTGIS CAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPT TPTPTPPLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Calcium channel blockers ELISA kit
GTR10392503 96 Well

Canine Calcium channel blockers ELISA kit

Sign In for Pricing
View Details
KRT8 Antibody
CSB-PA935926-01 50 μL

KRT8 Antibody

Sign In for Pricing
View Details
KRT8 Antibody
CSB-PA935926-02 100 µL

KRT8 Antibody

Sign In for Pricing
View Details
Myo9a sgRNA CRISPR Lentivector (Rat) (Target 3)
K6980204 1.0 µg DNA

Myo9a sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
INTS5 Antibody Blocking peptide
orb1453541 500 µg

INTS5 Antibody Blocking peptide

Sign In for Pricing
View Details
Monkey IL-2 ELISA antibody pair
CT711-20 20 Plates

Monkey IL-2 ELISA antibody pair

Sign In for Pricing
View Details