Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Phosphoglycerate transport regulatory protein pgtC (pgtC)

This Recombinant Salmonella typhimurium Phosphoglycerate transport regulatory protein pgtC (pgtC) spans the amino acid sequence from region 25-397.

Product Specifications

Product Name Alternative

Phosphoglycerate transport regulatory protein pgtC

UniProt

P0A233

Expression Region

25-397

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALL DSAPAASQKLVPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALL MSSPSRSDTNHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGP VIDNYANLLLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILAD ANTGKYPVAPLSADNPRAAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDA WRALHSAETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLN NQRLAIHKLEELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details