Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inhibitor of nuclear factor kappa-B kinase-interacting protein (Ikbip)

This Recombinant Mouse Inhibitor of nuclear factor kappa-B kinase-interacting protein (Ikbip) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Inhibitor of nuclear factor kappa-B kinase-interacting protein, I kappa-B kinase-interacting protein, IKBKB-interacting protein, IKK-interacting protein

UniProt

Q9DBZ1

Expression Region

1-373

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEVKSRKKPGPKVAAPEPEKRSDGRKNPEARGDAGWADPRTGLSLLSLAMTLGLAWLVF QQSEKFAKVEKQYRLLQTESSEFQGLQSKISLISSKLESTENTLQEATSSISLMTQFEQE VSGLQRSIRDIETSEEMLTQKMQNLNEKFQNITDFWKRTLAEMIDDTAVFKSEVKDTHSE VTLKINSADQEIKSLTERLKDLEDSTLRNIRTVSRQEEEDLLRVEAQLSSDTKAVKKLEE EQHTLLARDEDLTNKLSSYEPKVEECKAHFPTIENAVHSVLRVSQDLIGTERKMEELTMQ MFNMEDDMLRAVSEIMEMQKTLEGIQYDNSLLKMQNELVVLKGKVHDFIAYSSAREKGTL GEYSLGNKGTDEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF647 conjugate, 0.1mg/mL
BNC471778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details