Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant GDP-mannose-dependent alpha- (1-2) -phosphatidylinositol mannosyltransferase

This Recombinant GDP-mannose-dependent alpha- (1-2) -phosphatidylinositol mannosyltransferase spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

GDP-mannose-dependent alpha- (1-2) -phosphatidylinositol mannosyltransferase, EC= 2.4.1.57, Alpha-mannosyltransferase, Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase, Phos

UniProt

O07147

Expression Region

1-374

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRIGMICPYSFDVPGGVQSHVLQLAEVMRARGQQVRVLAPASPDVSLPEYVVSAGRAIPI PYNGSVARLQFSPAVHSRVRRWLVDGDFDVLHLHEPNAPSLSMWALRVAEGPIVATFHTS TTKSLTLSVFQGVLRPWHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVNVDSLSSAPQ LAGYPRLGKTVLFLGRYDEPRKGMSVLLDALPGVMECFDDVQLLIVGRGDEEQLRSQAGG LVEHIRFLGQVDDAGKAAAMRSADVYCAPNIGGESFGIVLVEAMAAGTPVVASDLDAFRR VLRDGEVGHLVPAGDSAALADALVALLRNDVLRERYVAAGAEAVRRYDWSVVASQIMRVY ETVATSGSKVQVAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details