Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dipeptidase pepE (pepE)

This Recombinant Probable dipeptidase pepE (pepE) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Probable dipeptidase pepE, EC= 3.4.13.-

UniProt

P65810

Expression Region

1-375

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAA GAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPAL HMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEA DVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYH SDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYF VHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAV SVNNCPHELIVVPVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0490208 1.0 µg DNA

COQ2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TIMM23B 3'UTR Luciferase Stable Cell Line
TU025598 1.0 mL

TIMM23B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MMAA, NT (MMAA, Methylmalonic aciduria type A protein, mitochondrial)
038490 200 µL

MMAA, NT (MMAA, Methylmalonic aciduria type A protein, mitochondrial)

Sign In for Pricing
View Details
Phospho-IKK gamma (Ser43) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5393R-PerCP-Cy5.5 100 µL

Phospho-IKK gamma (Ser43) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Zdhhc15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50784114 3x 1.0 µg

Zdhhc15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
M7C-2000-595-TN Continuous Tapes for Printers
173242 1 Box (1 Roll x 1 Roll)

M7C-2000-595-TN Continuous Tapes for Printers

Sign In for Pricing
View Details