Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0754 membrane protein SSP0953 (SSP0953)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0754 membrane protein SSP0953 (SSP0953) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

UPF0754 membrane protein SSP0953

UniProt

Q49YN9

Expression Region

1-376

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTFLVIIFMMVIGALIGGVTNVIAVKMLFHPFKTYYIFKKRVPFTPGLIPNRRKEIADK IGQVVEEHLLTEEVIQAKLNAPTSRDAIEEIIFKQIAKLKENHTTIQSLADIVDIDFSKT ANQKLDELISDKMDNFYLDYQNTPIQQLIPNDIESSIDDKVALLPELLFDRARVYLKSEK GGADIASMLDTFFNEKGKIVGMLQMFMTKESIAERIQHELIRLTSHPKAKAIATQIIENE YATMKSKQLNELINETQYQAFKTSVTELALRYVDLEQTSHKPLHTIMPRFISFLETKVSK TLTDVIIDNASKHLSPIMKKINLRQMVEEQINTFDLAYIEKLIIDIANKELKLIMFLGFL LGGIIGLFQGVIAIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details