Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0644c (Mb0644c)

This Recombinant Uncharacterized protein Mb0644c (Mb0644c) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0644c

UniProt

P64730

Expression Region

1-383

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHTDQAVDLLAAVQASVE PAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVRTGSGALITGYRFDRTA HDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRGDTRLFRDRDVLTSGLVG VRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPLHRLREIVLGMAPDEQELV SRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGEVVEVGATVQFQVRDAAAAD KDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHDASTIEDLLGGIPLAGFFAAG EIGPVAGHNALHGFTASMALFVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paraoxonase 2 Antibody / PON2
F54835-0.08ML 0.08 mL

Paraoxonase 2 Antibody / PON2

Sign In for Pricing
View Details
Cyclin B2 discontinued
508498 100 µg

Cyclin B2 discontinued

Sign In for Pricing
View Details
TMP21/TMED10 Rabbit Polyclonal Antibody (FITC)
orb2991326 100 µg

TMP21/TMED10 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Uhmk1, NT (Uhmk1, Kis, Kist, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (AP) discontinued
043589-AP 200 µL

Uhmk1, NT (Uhmk1, Kis, Kist, Serine/threonine-protein kinase Kist, Kinase interacting with stathmin, U2AF homology motif kinase 1) (AP) discontinued

Sign In for Pricing
View Details
ZZZ3 siRNA (Human)
orb1859609-01 15 nmol

ZZZ3 siRNA (Human)

Sign In for Pricing
View Details
ZZZ3 siRNA (Human)
orb1859609-02 30 nmol

ZZZ3 siRNA (Human)

Sign In for Pricing
View Details