Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella quintana Type IV secretion system protein virB10 (virB10)

This Recombinant Bartonella quintana Type IV secretion system protein virB10 (virB10) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB10

UniProt

Q6FYW1

Expression Region

1-385

Origin

Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDEIDENNINDRSTIKDGQGKKLHSNTSKAVALLVLLGVCGYLAYSTLITNKKQPVELP KEAIIKQTERFRPAQPKPVLLEPTEKNNLLLPKVELPTPKRNQTNADDSLLEAAQRAPVL AYASPQKSQANAEKNNDTSPNQLERKPDETAQRFNHLLKPTNLEGIHASTLTNRNYIIAM GASIPCILETAISSDQQGFTSCIVSRDILSDNGRVVLLDKGTQIVGEYRSGLKKGQNRLF VLWNRAKTPSGVIITLASPATDALGRSGVDGDVDNHWFERIGSALLVSIVRDATNYARNR LPKDQDKNSSDTISSGPNIANIVVENYANIPPTLTKNQGEMVNVFVARDLDFSSVYKLKV IEDKKQIVNRSISRNFYKNSAVILK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nup210l (NM_029937) Mouse Tagged ORF Clone
MG224105 10 µg

Nup210l (NM_029937) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SEPHS1 (F-6) : m-IgGκ BP-HRP Bundle
sc-522437 1 Kit

SEPHS1 (F-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Pig Brain natriuretic peptide (BNP) ELISA Kit
AE54191PI-01 48 Tests

Pig Brain natriuretic peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Pig Brain natriuretic peptide (BNP) ELISA Kit
AE54191PI-02 96 Tests

Pig Brain natriuretic peptide (BNP) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytochrome b (MT CYB) ELISA kit
GTR10397136 96 Well

Porcine Cytochrome b (MT CYB) ELISA kit

Sign In for Pricing
View Details
MYCN siRNA (Rat)
orb1829291-01 15 nmol

MYCN siRNA (Rat)

Sign In for Pricing
View Details