Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella quintana Type IV secretion system protein virB10 (virB10)

This Recombinant Bartonella quintana Type IV secretion system protein virB10 (virB10) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB10

UniProt

Q6FYW1

Expression Region

1-385

Origin

Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDEIDENNINDRSTIKDGQGKKLHSNTSKAVALLVLLGVCGYLAYSTLITNKKQPVELP KEAIIKQTERFRPAQPKPVLLEPTEKNNLLLPKVELPTPKRNQTNADDSLLEAAQRAPVL AYASPQKSQANAEKNNDTSPNQLERKPDETAQRFNHLLKPTNLEGIHASTLTNRNYIIAM GASIPCILETAISSDQQGFTSCIVSRDILSDNGRVVLLDKGTQIVGEYRSGLKKGQNRLF VLWNRAKTPSGVIITLASPATDALGRSGVDGDVDNHWFERIGSALLVSIVRDATNYARNR LPKDQDKNSSDTISSGPNIANIVVENYANIPPTLTKNQGEMVNVFVARDLDFSSVYKLKV IEDKKQIVNRSISRNFYKNSAVILK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1BP1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-16694R-BF555 100 µL

IRAK1BP1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)
abx228006-01 50 Tests

B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)

Sign In for Pricing
View Details
B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)
abx228006-02 100 Tests

B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)

Sign In for Pricing
View Details
B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)
abx228006-03 100 µg

B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)

Sign In for Pricing
View Details
B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)
abx228006-04 200 Tests

B-Lymphocyte Antigen CD19 (CD19) Antibody (APC)

Sign In for Pricing
View Details
Mouse MYH7 siRNA
abx925156-01 15 nmol

Mouse MYH7 siRNA

Sign In for Pricing
View Details