Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrB (ctrB)

This Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrB (ctrB) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein CtrB

UniProt

P57034

Expression Region

1-387

Origin

Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQS SFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVQEYMQSRSALDALRKKMPIRDFYEK EGDIFSRFNGFGLRGEDEAFYQYYRDKVSIHFDSVSGISNLSVTSFNAGESQKINDALLK QGEVLINQLNERARQDTIRYAQEVVNSAEEQVKEASVQLTKFRVSNGIFDLKAQSDVQMG LVSKLQDELIVIQTQLDQVKAVTPENPQIPGLIAREKSLRKEISQQMKAISGGGEGSLSN QAAEYQRVYLENELAEKQLAAAMTSLESAKAEADRQQLYLEVISQPNKPDLAYEPNRLYN IVATFVIGLIVYGIVVLLSASIREHKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL
BNC472210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF594 conjugate, 0.1mg/mL
BNC942993-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), CF405S conjugate, 0.1mg/mL
BNC041022-500 1x 500 µL

Hepatocyte Specific (CPS1/1022), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details