Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrB (ctrB)

This Recombinant Neisseria meningitidis serogroup A / serotype 4A Capsule polysaccharide export inner-membrane protein CtrB (ctrB) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Capsule polysaccharide export inner-membrane protein CtrB

UniProt

P57034

Expression Region

1-387

Origin

Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQS SFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVQEYMQSRSALDALRKKMPIRDFYEK EGDIFSRFNGFGLRGEDEAFYQYYRDKVSIHFDSVSGISNLSVTSFNAGESQKINDALLK QGEVLINQLNERARQDTIRYAQEVVNSAEEQVKEASVQLTKFRVSNGIFDLKAQSDVQMG LVSKLQDELIVIQTQLDQVKAVTPENPQIPGLIAREKSLRKEISQQMKAISGGGEGSLSN QAAEYQRVYLENELAEKQLAAAMTSLESAKAEADRQQLYLEVISQPNKPDLAYEPNRLYN IVATFVIGLIVYGIVVLLSASIREHKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-MAP3K7 (human) -sgRNA3-Cas9-Puro
BZ61552 1 Vial

PLV3-U6-MAP3K7 (human) -sgRNA3-Cas9-Puro

Sign In for Pricing
View Details
ADAM28 Protein (N-His, Human)
P500259 100 µg

ADAM28 Protein (N-His, Human)

Sign In for Pricing
View Details
Human CCL3/MIP-1 alpha ELISA Kit, pink-ONE
K0331195P 96 Well

Human CCL3/MIP-1 alpha ELISA Kit, pink-ONE

Sign In for Pricing
View Details
Zfp592 Protein Vector (Rat) (pPM-C-HA)
PV317976 500 ng

Zfp592 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Beta Shield-Large Fixed 45° Angle - Curved Base
CSR-S2OT 1 Each

Beta Shield-Large Fixed 45° Angle - Curved Base

Sign In for Pricing
View Details
NADPH-cytochrome P450 Reductase (POR) Human ELISA Kit
C6071 96 Tests

NADPH-cytochrome P450 Reductase (POR) Human ELISA Kit

Sign In for Pricing
View Details