Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)

This Recombinant Human Glycine receptor subunit alpha-4 (GLRA4) spans the amino acid sequence from region 29-417.

Product Specifications

Product Name Alternative

Glycine receptor subunit alpha-4

UniProt

Q5JXX5

Expression Region

29-417

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFSSITKT TMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTD NKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLEDA PAVQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLL IVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLF VFAALLEYAAINFVSRQHKEFIRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGG PMEGSGIYSPQPPAPLLREGETTRKLYVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2954), CF405S conjugate, 0.1mg/mL
BNC042954-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2954), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF640R conjugate, 0.1mg/mL
BNC400521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
BNC040983-500 1x 500 µL

CD117 (KIT/983), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF647 conjugate, 0.1mg/mL
BNC471531-100 1x 100 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details