Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c biogenesis protein ccs1 (ccs1)

This Recombinant Cytochrome c biogenesis protein ccs1 (ccs1) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccs1

UniProt

O19913

Expression Region

1-396

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSITLKTNRIFRSCLNLATNLKFSITLFIIICIVSAIGTIIPQDKPKEFYMNTYSLKVL GMPLWKIIQLLSLEKIFYSNFYLILLLCLSFSLFFCSLKSQFPYLRTSRIIKLNNNNPPT SPLHESKKIKYNNIASKNDSSCVQLVSQGYKIYTFDKNLDKAGPLLIHLSLILILLGSAI HAFNDFIAQEMIPIYEVSHIQNVISSGRISKIPQTISLKASAFTVEHENEKVVKQFITNL AMLNSKGEVLKQGLVSVNHPLVYKQVYIFQMDWKLFGIRVNYGKNKIYEFPVQKIEANNE QQWSCTIPAKNQSKLILIFKNMSDEFYVYDNNQNFLKIGKINTPQLIRNTYFTVISKISG TGLQIKKDSSINIVYTGFLLLIIGLVINHKGSKKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-500 1x 500 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details