Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seipin (BSCL2)

This Recombinant Human Seipin (BSCL2) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Seipin, Bernardinelli-Seip congenital lipodystrophy type 2 protein

UniProt

Q96G97

Expression Region

1-398

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTV SHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVN QDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLE VELYADYRENSYVPTTGAIIEIHSKRIQLYGAYLRIHAHFTGLRYLLYNFPMTCAFIGVA SNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEE STPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTE ANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LYPD6 Antibody, Rabbit Polyclonal
MBS8109706-01 0.1 mL

Anti-LYPD6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-LYPD6 Antibody, Rabbit Polyclonal
MBS8109706-02 5x 0.1 mL

Anti-LYPD6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Mouse Hdhd2 qPCR Primer Pair
QM45402S 200 Tests

Mouse Hdhd2 qPCR Primer Pair

Sign In for Pricing
View Details
Cpsf7 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4154802 1.0 µg DNA

Cpsf7 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Horse Proteolipid Protein 1, Myelin ELISA Kit
MBS042245-01 48 Well

Horse Proteolipid Protein 1, Myelin ELISA Kit

Sign In for Pricing
View Details
Horse Proteolipid Protein 1, Myelin ELISA Kit
MBS042245-02 96 Well

Horse Proteolipid Protein 1, Myelin ELISA Kit

Sign In for Pricing
View Details