Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized serine protease yyxA (yyxA)

This Recombinant Bacillus subtilis Uncharacterized serine protease yyxA (yyxA) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Uncharacterized serine protease yyxA, EC= 3.4.21.-

UniProt

P39668

Expression Region

1-400

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDYEREEEHTTPEQPKRSKKGYFLSSLIGVIVGAVLMAFIMPYLSNEGLDTGALDQQQN NNGRESIRTVNVSVNNAVTKIVSNMSPAVVGVVNIQKSDIWGESGEAGSGSGVIYKKNDH SAYVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFGNSD KVKSGEPVIAIGNPLGLEFAGSVTQGVISGTERAIPVDSNGDGQPDWNAEVLQTDAAINP GNSGGALLNMDGKVIGINSMKIAESAVEGIGLSIPSKLVIPVIEDLERYGKVKRPFLGIE MKSLSDIASYHWDETLKLPKNVTNGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIV DLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKLSSADQLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lorcainide Hydrochloride
TRC-L469908-5MG 5 mg

Lorcainide Hydrochloride

Sign In for Pricing
View Details
PAQR5 (NM_001104554) Human Over-expression Lysate
LY426202 100 µg

PAQR5 (NM_001104554) Human Over-expression Lysate

Sign In for Pricing
View Details
Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein
TP309683 20 µg

Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein

Sign In for Pricing
View Details
Natural Convection Incubator BINC-7804
BINC-7804 1 Unit

Natural Convection Incubator BINC-7804

Sign In for Pricing
View Details
Glypican 5 (GPC5) (NM_004466) Human Over-expression Lysate
LC401421 20 µg

Glypican 5 (GPC5) (NM_004466) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Malat1 activation kit by CRISPRa
GA209185 1 Kit

Mouse Malat1 activation kit by CRISPRa

Sign In for Pricing
View Details