Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized serine protease yyxA (yyxA)

This Recombinant Bacillus subtilis Uncharacterized serine protease yyxA (yyxA) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Uncharacterized serine protease yyxA, EC= 3.4.21.-

UniProt

P39668

Expression Region

1-400

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDYEREEEHTTPEQPKRSKKGYFLSSLIGVIVGAVLMAFIMPYLSNEGLDTGALDQQQN NNGRESIRTVNVSVNNAVTKIVSNMSPAVVGVVNIQKSDIWGESGEAGSGSGVIYKKNDH SAYVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFGNSD KVKSGEPVIAIGNPLGLEFAGSVTQGVISGTERAIPVDSNGDGQPDWNAEVLQTDAAINP GNSGGALLNMDGKVIGINSMKIAESAVEGIGLSIPSKLVIPVIEDLERYGKVKRPFLGIE MKSLSDIASYHWDETLKLPKNVTNGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIV DLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKLSSADQLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-Chlorodehydroabietic Acid
TRC-C421856-2.5MG 2.5 mg

14-Chlorodehydroabietic Acid

Sign In for Pricing
View Details
Tdrd12 Mouse Gene Knockout Kit (CRISPR)
KN517375 1 Kit

Tdrd12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MADH7 (SMAD7) Rabbit Polyclonal Antibody
TA381754 100 µL

MADH7 (SMAD7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560898 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Human Nuclear Antigen (235-1), CF647 conjugate, 0.1mg/mL
BNC470099-500 1x 500 µL

Human Nuclear Antigen (235-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atoh7 Mouse Gene Knockout Kit (CRISPR)
KN501753 1 Kit

Atoh7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details