Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 246 (TMEM246)

This Recombinant Pongo abelii Transmembrane protein 246 (TMEM246) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Transmembrane protein 246

UniProt

Q5R868

Expression Region

1-403

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQEFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAVPEEQIFPVLEHLLRARFSEPHLRDA LYLKLYHPERLQHYTNPEPMRILEWVGVGMLLGPLLTWIYMRFASRPGFSWPVMLFFSLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppp6r1 shRNA (UAS) - Lentiviral mouse Ppp6r1 shRNA (UAS) (100)
GTR15193602 1 Vial

Lentiviral mouse Ppp6r1 shRNA (UAS) - Lentiviral mouse Ppp6r1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Hsa-miR-615-5p miRNA Inhibitor
CIH0629-01 10 nmol

Hsa-miR-615-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-615-5p miRNA Inhibitor
CIH0629-02 20 nmol

Hsa-miR-615-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mouse Interleukin 13 (IL-13) ELISA Kit
YP-W20167-01 48 Tests

Mouse Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 13 (IL-13) ELISA Kit
YP-W20167-02 96 Tests

Mouse Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
EXOSC7 antibody
10R-6934 100 µL

EXOSC7 antibody

Sign In for Pricing
View Details