Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Hemagglutinin-esterase (HE)

This Recombinant Bovine coronavirus Hemagglutinin-esterase (HE) spans the amino acid sequence from region 19-424.

Product Specifications

Product Name Alternative

Hemagglutinin-esterase, HE protein, EC= 3.1.1.53, E3 glycoprotein

UniProt

P59709

Expression Region

19-424

Origin

Bovine coronavirus (strain Quebec) (BCoV) (BCV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGLNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL
BNC402343-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL
BNC940563-500 1x 500 µL

Cytokeratin 18 (DE-K18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF640R conjugate, 0.1mg/mL
BNC402488-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF647 conjugate, 0.1mg/mL
BNC471990-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2961), CF740 conjugate, 0.1mg/mL
BNC742961-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2961), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details