Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Abhydrolase domain-containing protein 3 (Abhd3)

This Recombinant Mouse Abhydrolase domain-containing protein 3 (Abhd3) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 3, EC= 3.1.1.-, Lung alpha/beta hydrolase 3, MmLABH3

UniProt

Q91ZH7

Expression Region

1-411

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRLAMDLRVLSRELALYLEHQVRVGFFGSGVGLSLILGFSVAYACYYLSSIAKKPQLVI GGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFITSKPPVQYRNELIKTADGGQI SLDWFDNNNSAYYVDASTRPTILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVA GESLLTPRTYCCANTEDLEAVVHHVHSLYPGAPFLAAGVSMGGMLLLNYLGKIGSKTPLM AAATFSVGWNTFACSESLERPLNWLLFNYYLTTCLQSSVKKHRHMFVEQIDMDQVMKAKS IREFDKRFTAVMFGYRTLDDYYTDASPNRRLKSVGIPVLCLNATDDVFSPSHAIPIETAK QNPNVALVLTAYGGHIGFLEGIWPRQCTYMDRVFKQFVQAMVEHGHELSNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium bis(1H,1H,2H,2H-[1,2-13C2]Perfluorooctyl)phosphate
TRC-S268682-5MG 5 mg

Sodium bis(1H,1H,2H,2H-[1,2-13C2]Perfluorooctyl)phosphate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS704031 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL
BNC400155-500 1x 500 µL

CD19 (CVID3/155), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAOK3 Human Gene Knockout Kit (CRISPR)
KN401031 1 Kit

TAOK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZJ 43
TRC-Z485110-100MG 100 mg

ZJ 43

Sign In for Pricing
View Details
1-Chloronaphthalene (Technical Grade)
TRC-C370910-250G 250 g

1-Chloronaphthalene (Technical Grade)

Sign In for Pricing
View Details