Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU07_0530 (ECU07_0530)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU07_0530 (ECU07_0530) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU07_0530

UniProt

Q8SV25

Expression Region

1-412

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLRAAGGRLWKKEPIKFYYKYPFARRGKMRAETSSGSKRTFKTLRTGFLGLVGVIAVY YALLFIFGIKYLNPQYYGSYFYAWRVNFADKLMTHGRYKLIKKNEHPETEDRKRFYRISQ DKEGPYLIRFDRPEHFPRGHEHQFSLNFPAYEDFLKVRERFIVESEGLQENMKLEHSDLM EQMKKEKGGLFFASYSGKSVEEMMRILFPNNNADRNPWFDVSNILIRAVSRIMSQDEKDR EGYLFDGSEVGDDLMKDIREGLDALDRSAGDGDVLLSEKISDADIKNFFINNGRVSGTPQ ETFAYSRLYYLFNFLTAGIEFKSERLAELRGDGESSNEFREARMDYVANVFARIFASIYP NQHKKDVSNIGVLEKVRNYYSPKMTVDPEKEVDDADLELVRESFSRSSRISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-500 1x 500 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details