Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhF2 (mnhF2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhF2 (mnhF2) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhF2, Mrp complex subunit F2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q8CQ45

Expression Region

1-100

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEMFTQIFIISALVIFGMALLVCLVRLIKGPTTADRVVSFDASSAVVMSIVGVMSVIFN SVSYLDSIMLIAIISFVSSVSISRFIGEGRVFNGNHKRHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-01 0.02 mg (E-Coli)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-02 0.02 mg (Yeast)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-03 0.1 mg (E-Coli)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-04 0.1 mg (Yeast)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-05 0.02 mg (Baculovirus)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Protein hedgehog (hh)
MBS1249668-06 0.02 mg (Mammalian-Cell)

Recombinant Drosophila persimilis Protein hedgehog (hh)

Sign In for Pricing
View Details