Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Signal peptidase complex subunit 1 (SPCS1)

This Recombinant Pongo abelii Signal peptidase complex subunit 1 (SPCS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

Q5RF96

Expression Region

1-102

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Synthase Recombinant Rabbit mAb
orb2326593-01 25 µL

Fatty Acid Synthase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Fatty Acid Synthase Recombinant Rabbit mAb
orb2326593-02 50 µL

Fatty Acid Synthase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Fatty Acid Synthase Recombinant Rabbit mAb
orb2326593-03 100 µL

Fatty Acid Synthase Recombinant Rabbit mAb

Sign In for Pricing
View Details
ENPP2, ID (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 2, E-NPP 2, Extracellular Lysophospholipase D, LysoPLD, Autotaxin, ATX, PDNP2) (PE)
E3224-02A-PE 200 µL

ENPP2, ID (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 2, E-NPP 2, Extracellular Lysophospholipase D, LysoPLD, Autotaxin, ATX, PDNP2) (PE)

Sign In for Pricing
View Details
Azlocillin
SD094-1PK 1 unit

Azlocillin

Sign In for Pricing
View Details
NADPH Oxidase Activator 1 (NOXA1) Antibody (HRP)
abx312958-01 20 µg

NADPH Oxidase Activator 1 (NOXA1) Antibody (HRP)

Sign In for Pricing
View Details