Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Signal peptidase complex subunit 1 (SPCS1)

This Recombinant Pongo abelii Signal peptidase complex subunit 1 (SPCS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

Q5RF96

Expression Region

1-102

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pterisolic acid F
582980 5 mg

Pterisolic acid F

Sign In for Pricing
View Details
WYE-125132 (WYE-132)
B1642-1 1 mg

WYE-125132 (WYE-132)

Sign In for Pricing
View Details
Recombinant Mouse Histone Deacetylase 2 (HDAC2)
RPU57084-01 50 µg

Recombinant Mouse Histone Deacetylase 2 (HDAC2)

Sign In for Pricing
View Details
Recombinant Mouse Histone Deacetylase 2 (HDAC2)
RPU57084-02 100 µg

Recombinant Mouse Histone Deacetylase 2 (HDAC2)

Sign In for Pricing
View Details
Recombinant Mouse Histone Deacetylase 2 (HDAC2)
RPU57084-03 1 mg

Recombinant Mouse Histone Deacetylase 2 (HDAC2)

Sign In for Pricing
View Details
MLK4 (Mixed Lineage Kinase 4, dJ862P8.3, KIAA1804, Mitogen-activated Protein Kinase Kinase Kinase, RP5-862P8.2) (MaxLight 550) discontinued
M4125-20-ML550 100 µL

MLK4 (Mixed Lineage Kinase 4, dJ862P8.3, KIAA1804, Mitogen-activated Protein Kinase Kinase Kinase, RP5-862P8.2) (MaxLight 550) discontinued

Sign In for Pricing
View Details