Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBL070C (YBL070C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBL070C (YBL070C) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YBL070C

UniProt

P38186

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPVLVWNISDLIGMNFTCLKGLATLFKTGASIGISLGAGAECSTIIACNLGSWFFKISL AIVQRLPLGMQCRICSFRNARQGGNIPELALIIICTFIYFLYFSLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTAP (NM_002451) Human Over-expression Lysate
LC419313 20 µg

MTAP (NM_002451) Human Over-expression Lysate

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF488A conjugate, 0.1mg/mL
BNC882442-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLJ31958 Human qPCR Primer Pair (NM_153030)
HP218028 200 Reactions

FLJ31958 Human qPCR Primer Pair (NM_153030)

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL
BNCB2166-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BNP (NPPB) Human Gene Knockout Kit (CRISPR)
KN206590 1 Kit

BNP (NPPB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,4,6-Trichlorophen-3,5-d2-ol
TRC-T774153-25MG 25 mg

2,4,6-Trichlorophen-3,5-d2-ol

Sign In for Pricing
View Details