Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Universal stress protein B (uspB)

This Recombinant Cronobacter sakazakii Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A7MKM3

Expression Region

1-111

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALFLVCVINMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTAHGQPSKQI RLVWYIYWQRYLDHHDDEFIRRCERVRRQFILTSALCGLVIISLIGLMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pebp1 Rabbit Polyclonal Antibody
AP08722SU-N 100 µL

Pebp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Dermcidin (DCD) ELISA Kit
RDR-DCD-Ra-01 96 Tests

Rat Dermcidin (DCD) ELISA Kit

Sign In for Pricing
View Details
Rat Dermcidin (DCD) ELISA Kit
RDR-DCD-Ra-02 48 Tests

Rat Dermcidin (DCD) ELISA Kit

Sign In for Pricing
View Details
Human RANKL Recombinant Rabbit monoclonal Antibody
HA723862 100 µL

Human RANKL Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS712929 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
2-Diethoxyphosphoryl-2-phenethyl-pyrrolidine
TRC-D442090-250MG 250 mg

2-Diethoxyphosphoryl-2-phenethyl-pyrrolidine

Sign In for Pricing
View Details