Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Universal stress protein B (uspB)

This Recombinant Cronobacter sakazakii Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A7MKM3

Expression Region

1-111

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALFLVCVINMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTAHGQPSKQI RLVWYIYWQRYLDHHDDEFIRRCERVRRQFILTSALCGLVIISLIGLMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICA (NM_001177519) Human Over-expression Lysate
LY432900 100 µg

MICA (NM_001177519) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc54 Mouse Gene Knockout Kit (CRISPR)
KN502722 1 Kit

Ccdc54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WDR26 Human Gene Knockout Kit (CRISPR)
KN424575 1 Kit

WDR26 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Agrn Mouse Gene Knockout Kit (CRISPR)
KN500995 1 Kit

Agrn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody (HRP)
KH-448-01 50 μL

SARS-CoV-2 Nucleoprotein Antibody (HRP)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody (HRP)
KH-448-02 100 µL

SARS-CoV-2 Nucleoprotein Antibody (HRP)

Sign In for Pricing
View Details