Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Universal stress protein B (uspB)

This Recombinant Cronobacter sakazakii Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A7MKM3

Expression Region

1-111

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALFLVCVINMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTAHGQPSKQI RLVWYIYWQRYLDHHDDEFIRRCERVRRQFILTSALCGLVIISLIGLMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF568 conjugate, 0.1mg/mL
BNC682418-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF640R conjugate, 0.1mg/mL
BNC403347-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,1,1,3,8,10,10,10-Octachlorodecane
TRC-O185035-5MG 5 mg

1,1,1,3,8,10,10,10-Octachlorodecane

Sign In for Pricing
View Details
NARS1 Rabbit Polyclonal Antibody
TA378931 100 µL

NARS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cofilin 1 (CFL1) (+ Cofilin 2) Rabbit Polyclonal Antibody
AP08086PU-S 50 µL

Cofilin 1 (CFL1) (+ Cofilin 2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Cyanopyrazole
TRC-C989395-2.5G 2.5 g

4-Cyanopyrazole

Sign In for Pricing
View Details