Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF112 (ORF112)

This Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF112 (ORF112) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF112

UniProt

A4ZUC9

Expression Region

1-112

Origin

Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCQIYPSQMCPGKAYKNCKLNIMNFWEVICIYYFALQGSFLGILVNLPILVTTLPLLPP ALFFYLMYLFALPLKDIFNIFFPSLDPILIPILIFFLVGVSRARLSKVFKWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF594 conjugate, 0.1mg/mL
BNC940680-100 1x 100 µL

Cyclin B1 (V92.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL
BNC040172-100 1x 100 µL

CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details