Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2)

This Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q0S2P8

Expression Region

1-114

Origin

Rhodococcus sp. (strain RHA1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLLVALGGALGATTRYLTGRYVDSYRSFPVATFLVNVAGCLILGLLSGASLSEQTFAL LGTGFCGGLTTYSTFAVESVGLLRIRRALPSVVYVVASVAAGLAAAWLGFRLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C2 Human Knockdown Lysate
LY300506 100 µg

NR2C2 Human Knockdown Lysate

Sign In for Pricing
View Details
Ssty2 Mouse Gene Knockout Kit (CRISPR)
KN516781 1 Kit

Ssty2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,4,5-Trichloroaniline-13C6
TRC-T774093-1MG 1 mg

2,4,5-Trichloroaniline-13C6

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]
HA720116F 100 µL

iFluor™ 594 Conjugated Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS623159 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Recombinant Human ACSL4 Protein (Trx Tag)
PDEH100615-01 20 µg

Recombinant Human ACSL4 Protein (Trx Tag)

Sign In for Pricing
View Details