Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2)

This Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q0S2P8

Expression Region

1-114

Origin

Rhodococcus sp. (strain RHA1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLLVALGGALGATTRYLTGRYVDSYRSFPVATFLVNVAGCLILGLLSGASLSEQTFAL LGTGFCGGLTTYSTFAVESVGLLRIRRALPSVVYVVASVAAGLAAAWLGFRLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF640R conjugate, 0.1mg/mL
BNC403788-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bromo-Afatinib
TRC-A355405-10MG 10 mg

Bromo-Afatinib

Sign In for Pricing
View Details
CD1C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A8]
TA505398AM 100 µL

CD1C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A8]

Sign In for Pricing
View Details
ZNF843 Human Gene Knockout Kit (CRISPR)
KN427966 1 Kit

ZNF843 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclohexylacetic acid
TRC-C991910-100MG 100 mg

Cyclohexylacetic acid

Sign In for Pricing
View Details
N4-Benzoyl-2’-deoxy-5’-O-DMT-cytidine 3’-CE Phosphoramidite
TRC-B207930-1G 1 g

N4-Benzoyl-2’-deoxy-5’-O-DMT-cytidine 3’-CE Phosphoramidite

Sign In for Pricing
View Details