Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2)

This Recombinant Rhodococcus sp. Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q0S2P8

Expression Region

1-114

Origin

Rhodococcus sp. (strain RHA1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLLVALGGALGATTRYLTGRYVDSYRSFPVATFLVNVAGCLILGLLSGASLSEQTFAL LGTGFCGGLTTYSTFAVESVGLLRIRRALPSVVYVVASVAAGLAAAWLGFRLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271D-01 20 Tests

PE Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
PE Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271D-02 100 Tests

PE Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
PE Anti-Human CD8a Antibody[HIT8a]
E-AB-F1271D-03 2x 100 Tests

PE Anti-Human CD8a Antibody[HIT8a]

Sign In for Pricing
View Details
Sodium 2-Hydroxyethanesulfonate
TRC-S699373-5G 5 g

Sodium 2-Hydroxyethanesulfonate

Sign In for Pricing
View Details
Histone H3 Rabbit Polyclonal Antibody
AP06394PU-N 100 µg

Histone H3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Benzoyloxindole
TRC-B208155-50MG 50 mg

7-Benzoyloxindole

Sign In for Pricing
View Details