Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1991 (AF_1991)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1991 (AF_1991) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1991

UniProt

O28288

Expression Region

1-118

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEPFLLAVEGQEFLTGFHVEGPLAGLIIILIALLLLWIFKKVLKLVVVLIGAVVGYFVG EAVEPSLSLVFAAGFAIVGIWAMSGDKSKKKGKKQRSILKDADDWDDDSWDDEGDWDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-PEG23-amine
HY-140901 1 Each

Biotin-PEG23-amine

Sign In for Pricing
View Details
rno-miR-653-5p miRNA Antagomir
MBS8320792-01 10 nmol

rno-miR-653-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-653-5p miRNA Antagomir
MBS8320792-02 20 nmol

rno-miR-653-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-653-5p miRNA Antagomir
MBS8320792-03 5x 20 nmol

rno-miR-653-5p miRNA Antagomir

Sign In for Pricing
View Details
CD24 (2Q1282) : m-IgG Fc BP-HRP Bundle
sc-539299 1 Kit

CD24 (2Q1282) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral human LGALS16 shRNA (UAS) - Lentiviral human LGALS16 shRNA (UAS) (25)
GTR15128057 1 Vial

Lentiviral human LGALS16 shRNA (UAS) - Lentiviral human LGALS16 shRNA (UAS) (25)

Sign In for Pricing
View Details