Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1991 (AF_1991)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1991 (AF_1991) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1991

UniProt

O28288

Expression Region

1-118

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEPFLLAVEGQEFLTGFHVEGPLAGLIIILIALLLLWIFKKVLKLVVVLIGAVVGYFVG EAVEPSLSLVFAAGFAIVGIWAMSGDKSKKKGKKQRSILKDADDWDDDSWDDEGDWDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SMOC2 ELISA KIT (1 x 96 wells)
EA102477 96 Well

Human SMOC2 ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
5HT7 Receptor Polyclonal Antibody, APC Conjugated
bs-12056R-APC 100 µL

5HT7 Receptor Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Anti-TRIM27 Polyclonal Antibody
PAV4131 100 μL

Rabbit Anti-TRIM27 Polyclonal Antibody

Sign In for Pricing
View Details
KOX4 Polyclonal Antibody
MBS8523473-01 0.1 mg

KOX4 Polyclonal Antibody

Sign In for Pricing
View Details
KOX4 Polyclonal Antibody
MBS8523473-02 0.1 mL (AF635)

KOX4 Polyclonal Antibody

Sign In for Pricing
View Details
KOX4 Polyclonal Antibody
MBS8523473-03 0.1 mL (AF610)

KOX4 Polyclonal Antibody

Sign In for Pricing
View Details