Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 (OST2)

This Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 (OST2) spans the amino acid sequence from region 2-130.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2, Oligosaccharyl transferase subunit OST2, EC= 2.4.1.119, Oligosaccharyl transferase 16 kDa subunit, Oligos

UniProt

P46964

Expression Region

2-130

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKAPKANTPKVTSTSSAVLTDFQETFKTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQ CTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLCNSFPGISKNRAFAEFIVASLIL HFVCLHFIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF640R conjugate, 0.1mg/mL
BNC401993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470835-500 1x 500 µL

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF405S conjugate, 0.1mg/mL
BNC042808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details