Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1080 (MJ1080)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1080 (MJ1080) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1080

UniProt

Q58480

Expression Region

1-135

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKIMNIKHKIPILLLVLYIALGVFIQYNGISEFKSLPSPIYGGDYYYQMGVIWHIRDG GNPLESSSMIGGMPGYLPLYAYLCAKFCDLLNLDTMKGILYFSVVLFIMTSVIWFYLFRV LFKDDWVALIEVVLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Matrix Metalloproteinase 3 (MMP3) ELISA Kit
RD-MMP3-Ra-01 96 Tests

Rat Matrix Metalloproteinase 3 (MMP3) ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 3 (MMP3) ELISA Kit
RD-MMP3-Ra-02 48 Tests

Rat Matrix Metalloproteinase 3 (MMP3) ELISA Kit

Sign In for Pricing
View Details
HMBOX1 (NM_001135726) Human Over-expression Lysate
LY427683 100 µg

HMBOX1 (NM_001135726) Human Over-expression Lysate

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), 0.2mg/mL
BNUB1009-100 1x 100 µL

CD66 (CEA) (C66/1009), 0.2mg/mL

Sign In for Pricing
View Details
N-Acetyl-DL-alanine
TRC-A167965-5G 5 g

N-Acetyl-DL-alanine

Sign In for Pricing
View Details
TMPRSS13 Rabbit Polyclonal Antibody
TA365083 100 µL

TMPRSS13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details