Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opalin (Opalin)

This Recombinant Mouse Opalin (Opalin) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10

UniProt

Q7M750

Expression Region

1-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSLNFTLPSNTTSSPVVTSAKATDCGPSIGLAAGIPSLLATALLVALLFTLIQRRRTI DDEPVEETEIPCEISELYDNPKISENPRRSPTHEMNPRGSQEGHIYVKTVSGSEEPLPDT YRPPEELERRRGLWWLVPSLSLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARIH2OS Rabbit Polyclonal Antibody
orb3070898-01 30 µL

ARIH2OS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARIH2OS Rabbit Polyclonal Antibody
orb3070898-02 50 µL

ARIH2OS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARIH2OS Rabbit Polyclonal Antibody
orb3070898-03 100 µL

ARIH2OS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARIH2OS Rabbit Polyclonal Antibody
orb3070898-04 200 µL

ARIH2OS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48680061 1.0 µg DNA

TTC29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Goat Olfactory receptor 2T10 (OR2T10) ELISA kit
GTR10391404 96 Well

Goat Olfactory receptor 2T10 (OR2T10) ELISA kit

Sign In for Pricing
View Details