Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opalin (Opalin)

This Recombinant Mouse Opalin (Opalin) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10

UniProt

Q7M750

Expression Region

1-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSLNFTLPSNTTSSPVVTSAKATDCGPSIGLAAGIPSLLATALLVALLFTLIQRRRTI DDEPVEETEIPCEISELYDNPKISENPRRSPTHEMNPRGSQEGHIYVKTVSGSEEPLPDT YRPPEELERRRGLWWLVPSLSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPEP HCl 5mg
A13236-5 5 mg

MPEP HCl 5mg

Sign In for Pricing
View Details
Lentiviral human PTCH2 shRNA (UAS) - Lentiviral human PTCH2 shRNA (UAS, RFP) plasmid
GTR15318004 1 Vial

Lentiviral human PTCH2 shRNA (UAS) - Lentiviral human PTCH2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Arrb2/Beta-arrestin-2 ELISA Kit
orb1661513 96 Tests

Rat Arrb2/Beta-arrestin-2 ELISA Kit

Sign In for Pricing
View Details
CSNK1G2 (Casein Kinase I Isoform gamma-2, CKI-gamma 2) (Biotin)
125409-Biotin 100 µL

CSNK1G2 (Casein Kinase I Isoform gamma-2, CKI-gamma 2) (Biotin)

Sign In for Pricing
View Details
CARD11 Antibody
MBS9404317-01 0.1 mL

CARD11 Antibody

Sign In for Pricing
View Details
CARD11 Antibody
MBS9404317-02 5x 0.1 mL

CARD11 Antibody

Sign In for Pricing
View Details