Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opalin (Opalin)

This Recombinant Mouse Opalin (Opalin) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Opalin, Oligodendrocytic myelin paranodal and inner loop protein, Transmembrane protein 10

UniProt

Q7M750

Expression Region

1-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSLNFTLPSNTTSSPVVTSAKATDCGPSIGLAAGIPSLLATALLVALLFTLIQRRRTI DDEPVEETEIPCEISELYDNPKISENPRRSPTHEMNPRGSQEGHIYVKTVSGSEEPLPDT YRPPEELERRRGLWWLVPSLSLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-epi-Obeticholic Acid
TRC-O099100-25MG 25 mg

6-epi-Obeticholic Acid

Sign In for Pricing
View Details
Dist1 Lentiviral Activation Particles (h)
sc-406805-LAC 200 µL

Dist1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TMPRSS2/Epitheliasin Rabbit anti-Human Polyclonal Antibody
MBS2404050-01 0.05 mg

TMPRSS2/Epitheliasin Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS2/Epitheliasin Rabbit anti-Human Polyclonal Antibody
MBS2404050-02 5x 0.05 mg

TMPRSS2/Epitheliasin Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
TWIST1 Antibody
MBS7105149-01 0.05 mg

TWIST1 Antibody

Sign In for Pricing
View Details
TWIST1 Antibody
MBS7105149-02 0.1 mg

TWIST1 Antibody

Sign In for Pricing
View Details