Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP (LAP)
This Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP (LAP) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase LAP, EC= 6.3.2.-, Leukemia associated protein, LAP
UniProt
Q6TV02
Expression Region
1-156
Origin
Yaba monkey tumor virus (strain VR587) (YMTV)
Field of Research
Infectious Disease & Virology; Cancer Biology; Molecular Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHY FSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYIS MILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 