Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q3AWF1
Expression Region
1-160
Origin
Synechococcus sp. (strain CC9902)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLVPFIESFNKF QNPFRRPVAMTVFLFGTFTTIYLGIGAAMPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725143 100 µL
Mouse/Rat Complement C3 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
BNC041700-500 1x 500 µL
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB1791-100 1x 100 µL
SOX2 (Transcription Factor) (SOX2/1791), 0.2mg/mL
Sign In for Pricing
View Details 
