Recombinant UPF0114 protein in repA1-repA2 intergenic region
This Recombinant UPF0114 protein in repA1-repA2 intergenic region spans the amino acid sequence from region 1-166.
Product Specifications
Product Name Alternative
UPF0114 protein in repA1-repA2 intergenic region
UniProt
Q53016
Expression Region
1-166
Origin
Buchnera aphidicola subsp. Rhopalosiphum padi
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEKIIEKSIYASRWLMFPVYVGLSFGFILTLKFFQQIIFIIPDILAMSESGLVLVVLSLI DIALVGGLLVMVMFSGYENFISKMDIQDNEKRLGWMGTMDVNSIKNKVASSIVAISSVHL LRLFMEAERILDNKIMLCVIIHLTFVLSAFGMAYIDKMSKKKHIIH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-H953675-25MG 25 mg
N-Hydroxysuccinimidyl trans-4-Isopropylcyclohexanecarboxylate
Sign In for Pricing
View Details 
PKSH030750 100 µg
Recombinant Human Resistin Protein (aa 17-108, Fc Tag)
Sign In for Pricing
View Details 
PKSH030336 50 µg
Recombinant Human AK4/AK3L1 Protein (His & GST Tag)
Sign In for Pricing
View Details