Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q1KVY1

Expression Region

1-178

Origin

Scenedesmus obliquus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSFLFLGNLPLAEGFGINTNIFETNIINLAAVVAIVISFVGKNLSALLEDRRKTIVNN LQEASQRAAEAQERLNIAKNQLEVAKKKATEIREEGVFRATQEINNCVAQHEERLSKLEE FKQETVQFYQQKAFKQAYVYIISRIMSRVKERLNKGLDATYHVVVNNFYVSRFTEYNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPP Antibody
OC-419-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
OC-419-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
OC-419-03 1 mL

CLPP Antibody

Sign In for Pricing
View Details
LRRC8C (NM_032270) Human Recombinant Protein
TP322603M 100 µg

LRRC8C (NM_032270) Human Recombinant Protein

Sign In for Pricing
View Details
Rpl10l Mouse Gene Knockout Kit (CRISPR)
KN515013 1 Kit

Rpl10l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CCNE1/Cyclin-E1 Protein (His & GST Tag)
PKSM040448 100 µg

Recombinant Mouse CCNE1/Cyclin-E1 Protein (His & GST Tag)

Sign In for Pricing
View Details