What is the catalog number for Recombinant Bovine RING finger protein 183 (RNF183)?

The catalog number for Recombinant Bovine RING finger protein 183 (RNF183) is orb2929834.

What sizes are available for Recombinant Bovine RING finger protein 183 (RNF183)?

Recombinant Bovine RING finger protein 183 (RNF183) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Bovine RING finger protein 183 (RNF183) come in?

Recombinant Bovine RING finger protein 183 (RNF183) is available in 2 different pack sizes.

Is Recombinant Bovine RING finger protein 183 (RNF183) in stock?

Recombinant Bovine RING finger protein 183 (RNF183) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Bovine RING finger protein 183 (RNF183)

This Recombinant Bovine RING finger protein 183 (RNF183) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

RING finger protein 183

UniProt

Q3SWY0

Expression Region

1-188

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHISLVTPTRRRLLCPLCRHP TVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGP EPASQAGQPQDVGPSTRPVPIRSRYSLRECFRNPHFRIFAYMMAVILCGTVLFIFSIFCT RRFFWGVG