Recombinant Ashbya gossypii Mitochondrial intermembrane space import and assembly protein 40 (MIA40)
This Recombinant Ashbya gossypii Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 29-266.
Product Specifications
Product Name Alternative
Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40
UniProt
Q757A5
Expression Region
29-266
Origin
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SSTLGGGKGSYNLDMPALALAAGVTLLAGYMVYPRAPKAKQAAVQSVAPVNENVEQASAS LQASAPVQATSESAEAGEEEAYGEESGAVNEEAAGEPEEAAAEVGETQAEQAPAVETEQA AEAEQAAEAAAEDKASAGEAAQGQQGAYNPDTGEINWDCPCLGGMAHGPCGEEFKAAFAC FVYSEAEPKGIDCVEKFQVMQDCFRQHPEHYAEQLESEEQAVRETEAAAESAKSDEGH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6679706 1.0 µg DNA
Plcxd3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
NBP2-73237 100 µg
Mouse Monoclonal pan Cadherin Antibody (OTI4F1) - Azide and BSA Free
Sign In for Pricing
View Details