Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisomal membrane protein 11A (Pex11a)

This Recombinant Rat Peroxisomal membrane protein 11A (Pex11a) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11A, 28 kDa peroxisomal integral membrane protein, PMP28, Peroxin-11A, Peroxisomal biogenesis factor 11A, Peroxisomal coatomer receptor, Peroxisomal m

UniProt

O70597

Expression Region

1-246

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ LKLKAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 Recombinant Rabbit monoclonal Antibody
HA750563 100 µL

MALT1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF640R conjugate, 0.1mg/mL
BNC402560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDw17 (H018.3G-6.F5), 0.2mg/mL
BNUB1092-500 1x 500 µL

CDw17 (H018.3G-6.F5), 0.2mg/mL

Sign In for Pricing
View Details
CH-PIATA
TRC-C394580-50MG 50 mg

CH-PIATA

Sign In for Pricing
View Details
CD3 zeta Recombinant Rabbit Monoclonal Antibody [JE09-37]
HA722692 100 µL

CD3 zeta Recombinant Rabbit Monoclonal Antibody [JE09-37]

Sign In for Pricing
View Details
Transmembrane Protein 175 (TMEM175) (NM_001297424) Human Tagged ORF Clone
RG238132 10 µg

Transmembrane Protein 175 (TMEM175) (NM_001297424) Human Tagged ORF Clone

Sign In for Pricing
View Details