Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse WAP four-disulfide core domain protein 8 (Wfdc8)

This Recombinant Mouse WAP four-disulfide core domain protein 8 (Wfdc8) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 8, Putative protease inhibitor WAP8C

UniProt

Q4KUS1

Expression Region

1-273

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKCGVPQRVPGDCFRPVSTRHPRQIPSCFSICFLTHEAQSLRALAHSWWSGALLLLLLF LFLSLEQTSTSYNAKIKQKVGECPRQRLECRNESLSSCKTDFNCKAHFKCCQFACGRKCM DPYEEPCMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNACMFV EKKGQCPLFPFQMRMECPASCKNDMDCPEKEKCCESRCGFICARVWLVKTGFCPRKPIVC SKIDKPKCLQDIDCPLDEKCCTRCGLKCLKPRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human TXN pAb
PA15884-01 50 μL

Rabbit Anti-Human TXN pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TXN pAb
PA15884-02 100 μL

Rabbit Anti-Human TXN pAb

Sign In for Pricing
View Details
Human colicin ELISA Kit
SL0479Hu-01 48 Tests

Human colicin ELISA Kit

Sign In for Pricing
View Details
Human colicin ELISA Kit
SL0479Hu-02 96 Tests

Human colicin ELISA Kit

Sign In for Pricing
View Details
Recombinant Human PTH7-84, 15N
P6987-500μg 500 µg

Recombinant Human PTH7-84, 15N

Sign In for Pricing
View Details
Her2/ERBB2 Protein, Mouse, Recombinant (His Tag)
MBS8122941-01 0.1 mg

Her2/ERBB2 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details