Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthroderma otae Probable endonuclease LCL3 (LCL3)

This Recombinant Arthroderma otae Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

C5FTB4

Expression Region

1-282

Origin

Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWLFWTSENDKDECKCNNKPSSNSDEKPSIILNSSKDWNALSNATNWSHFLEPSNLIPT VLLTSGILFAVRIHRRYLRRIPEATNISPSYLRQRSILGKVTSVGDGDNFRIYHTPGGML AGWGWLRKVPTSKKELKNNTIHIRIAGVDAPELAHFGRPSQPFGEEAHTWLTNRLIGRRI RAYVYRPDQYSRVVATVYAYRFLFFPQDIGLQMLREGLATIYEAKSGAEFGGPKQEKKYR DAEALAKKKGKGLWKAKASSDWESPRDFKSRMNAIDQGKGST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF488A conjugate, 0.1mg/mL
BNC880512-100 1x 100 µL

CD68 (KP1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF405S conjugate, 0.1mg/mL
BNC042153-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL
BNC041683-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL
BNC471149-100 1x 100 µL

CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details